ARG40208
anti-AMACR / p504S antibody
anti-AMACR / p504S antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes AMACR / p504S |
|---|---|
| Tested Reactivity | Hu, Rat |
| Predict Reactivity | Bov, Hrs, Mk |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | AMACR / p504S |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 208-246 of Human AMACR / p504S. (RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK) |
| Conjugation | Un-conjugated |
| Alternate Names | AMACR; Alpha-Methylacyl-CoA Racemase; P504S; RACE; 2-Methylacyl-CoA Racemase; EC 5.1.99.4; AMACRD; CBAS4; RM |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | AMACR |
| Gene Full Name | alpha-methylacyl-CoA racemase |
| Background | This gene encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene. |
| Function | Acts only on coenzyme A thioesters, not on free fatty acids, and accepts as substrates a wide range of alpha-methylacyl-CoAs, including pristanoyl-CoA, trihydroxycoprostanoyl-CoA (an intermediate in bile acid synthesis), and arylpropionic acids like the anti-inflammatory drug ibuprofen (2-(4-isobutylphenyl)propionic acid) but neither 3-methyl-branched nor linear-chain acyl-CoAs. |
| Cellular Localization | Mitochondrion, Peroxisome |
| Calculated MW | 42 kDa |
| PTM | Acetylation |
Images (1) Click the Picture to Zoom In
-
ARG40208 anti-AMACR / p504S antibody WB image
Western blot: Rat kidney, Rat liver and HepG2 whole cell lysates stained with ARG40208 anti-AMACR / p504S antibody at 0.5 µg/ml dilution.
