ARG58220
anti-ASIC2 antibody
anti-ASIC2 antibody for Western blot and Human,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes ASIC2 |
---|---|
Tested Reactivity | Hu, Rat |
Tested Application | WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | ASIC2 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to aa. 112-147 of Human ACCN1. (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK) |
Conjugation | Un-conjugated |
Alternate Names | ACCN1; ACCN; BNC1; Amiloride-sensitive cation channel 1, neuronal; MDEG; Mammalian degenerin homolog; Amiloride-sensitive cation channel neuronal 1; BNaC1; ASIC2; Amiloride-sensitive brain sodium channel; Acid-sensing ion channel 2; hBNaC1; ASIC2a; Brain sodium channel 1 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
Preservative | 0.05% Sodium azide |
Stabilizer | 5% BSA |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | ASIC2 |
Gene Full Name | acid sensing (proton gated) ion channel 2 |
Background | This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified. [provided by RefSeq, Feb 2012] |
Function | Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate. [UniProt] |
Cellular Localization | Cell membrane; Multi-pass membrane protein. Localized at the plasma membrane of neurons, in the soma and punctated peripheral processes. [UniProt] |
Calculated MW | 58 kDa |
Images (1) Click the Picture to Zoom In