ARG41272
anti-DHRS9 antibody
anti-DHRS9 antibody for Immunoprecipitation,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes DHRS9 |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Hu, Ms, Rat, Cow, Dog, Gpig, Hrs, Rb |
| Tested Application | IP, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | DHRS9 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human DHRS9. (within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV) |
| Conjugation | Un-conjugated |
| Alternate Names | Tracheobronchial epithelial cell-specific retinol dehydrogenase; 3-alpha-HSD; Short-chain dehydrogenase/reductase retSDR8; RDH-TBE; NADP-dependent retinol dehydrogenase/reductase; 3-alpha hydroxysteroid dehydrogenase; Dehydrogenase/reductase SDR family member 9; RDH15; RDHL; RDH-E2; RETSDR8; Short chain dehydrogenase/reductase family 9C member 4; Retinol dehydrogenase 15; RDHTBE; EC 1.1.-.-; SDR9C4; 3ALPHA-HSD |
Application Instructions
| Predict Reactivity Note | Predicted Homology Based On Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | THP-1 | ||||||
| Observed Size | ~ 32 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q9BPW9 Human Dehydrogenase/reductase SDR family member 9 |
|---|---|
| Gene Symbol | DHRS9 |
| Gene Full Name | dehydrogenase/reductase (SDR family) member 9 |
| Background | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
| Function | 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH. [UniProt] |
| Cellular Localization | Microsome membrane. Endoplasmic reticulum membrane. Note=Associated with microsomal membranes. [UniProt] |
| Calculated MW | 35 kDa |
Images (1) Click the Picture to Zoom In
-
ARG41272 anti-DHRS9 antibody WB image
Western blot: THP-1 cell lysate stained with ARG41272 anti-DHRS9 antibody at 0.2 - 1 µg/ml dilution.
