ARG58574

anti-FGB / Fibrinogen beta chain antibody

anti-FGB / Fibrinogen beta chain antibody for Flow cytometry,Western blot and Human,Mouse,Rat

publication_link Publication1

Overview

Product Description Rabbit Polyclonal antibody recognizes FGB / Fibrinogen beta chain
Tested Reactivity Hu, Ms, Rat
Tested Application FACS, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name FGB / Fibrinogen beta chain
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 193-225 of Human FGB / Fibrinogen beta chain. (TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT)
Conjugation Un-conjugated
Alternate Names Fibrinogen beta chain; HEL-S-78p

Application Instructions

Application Suggestion
Tested Application Dilution
FACS1:150 - 1:500
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA.
Preservative 0.05% Sodium azide
Stabilizer 5% BSA
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 110135 Mouse FGB

GeneID: 2244 Human FGB

GeneID: 24366 Rat FGB

Gene Symbol FGB
Gene Full Name fibrinogen beta chain
Background The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]
Function Cleaved by the protease thrombin to yield monomers which, together with fibrinogen alpha (FGA) and fibrinogen gamma (FGG), polymerize to form an insoluble fibrin matrix. Fibrin has a major function in hemostasis as one of the primary components of blood clots. In addition, functions during the early stages of wound repair to stabilize the lesion and guide cell migration during re-epithelialization. Was originally thought to be essential for platelet aggregation, based on in vitro studies using anticoagulated blood. However subsequent studies have shown that it is not absolutely required for thrombus formation in vivo. Enhances expression of SELP in activated platelets. Maternal fibrinogen is essential for successful pregnancy. Fibrin deposition is also associated with infection, where it protects against IFNG-mediated hemorrhage. May also facilitate the antibacterial immune response via both innate and T-cell mediated pathways. [UniProt]
Cellular Localization Secreted. [UniProt]
Calculated MW 56 kDa
PTM Conversion of fibrinogen to fibrin is triggered by thrombin, which cleaves fibrinopeptides A and B from alpha and beta chains, and thus exposes the N-terminal polymerization sites responsible for the formation of the soft clot. The soft clot is converted into the hard clot by factor XIIIA which catalyzes the epsilon-(gamma-glutamyl)lysine cross-linking between gamma chains (stronger) and between alpha chains (weaker) of different monomers. [UniProt]

Images (3) Click the Picture to Zoom In

  • ARG58574 anti-FGB / Fibrinogen beta chain antibody WB image

    Western blot: Mouse liver stained with ARG58574 anti-FGB / Fibrinogen beta chain antibody.

    From Hu PA et al. Nutrients (2022), doi: 10.3390/nu14112329, Fig. 3A.

  • ARG58574 anti-FGB / Fibrinogen beta chain antibody WB image

    Western blot: Rat kidney extract, Mouse liver extract and HeLa whole cell lysate stained with ARG58574 anti-FGB / Fibrinogen beta chain antibody at 0.5 µg/ml dilution.

  • ARG58574 anti-FGB / Fibrinogen beta chain antibody FACS image

    Flow Cytometry: A549 cells were blocked with 10% normal goat serum and then stained with ARG58574 anti-FGB / Fibrinogen beta chain antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.

Specific References

New Mechanisms of Bromelain in Alleviating Non-Alcoholic Fatty Liver Disease-Induced Deregulation of Blood Coagulation

WB / Mouse

Po-An Hu et al.
Nutrients,  (2022)

publication_link

 

hr_line