ARG58709
anti-FLT3 Ligand antibody
anti-FLT3 Ligand antibody for Western blot and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes FLT3 Ligand |
|---|---|
| Tested Reactivity | Hu, Rat |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | FLT3 Ligand |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 79-110 of Human Flt3 Ligand (AQRWMERLKTVAGSKMQGLLERVNTEIHFVTK). |
| Conjugation | Un-conjugated |
| Alternate Names | FLT3L; SL cytokine; Fms-related tyrosine kinase 3 ligand; Flt3L; Flt3 ligand; FL |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # P49771 Human Fms-related tyrosine kinase 3 ligand |
|---|---|
| Gene Symbol | FLT3LG |
| Gene Full Name | fms-related tyrosine kinase 3 ligand |
| Background | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011] |
| Function | Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins. [UniProt] |
| Cellular Localization | Isoform 1: Cell membrane; Single-pass type I membrane protein. [UniProt] |
| Calculated MW | 26 kDa |
Images (1) Click the Picture to Zoom In
-
ARG58709 anti-FLT3 Ligand antibody WB image
Western blot: 50 µg of Rat brain, 50 µg of Rat spleen, 50 µg of Rat kidney and 40 µg of SMMC whole cell lysates stained with ARG58709 anti-FLT3 Ligand antibody at 0.5 µg/ml dilution.
