ARG58712

anti-FMO2 antibody

anti-FMO2 antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes FMO2
Tested Reactivity Hu
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name FMO2
Antigen Species Human
Immunogen Synthetic peptide corresponding to aa. 78-115 of Human FMO2 (FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK).
Conjugation Un-conjugated
Alternate Names Pulmonary flavin-containing monooxygenase 2; FMO 1B1; Dimethylaniline oxidase 2; FMO1B1; Dimethylaniline monooxygenase [N-oxide-forming] 2; EC 1.14.13.8; FMO 2

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose.
Preservative 0.05% Sodium azide
Stabilizer 4% Trehalose
Concentration 0.5 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 2327 Human FMO2

Swiss-port # Q99518 Human Dimethylaniline monooxygenase [N-oxide-forming] 2

Gene Symbol FMO2
Gene Full Name flavin containing monooxygenase 2 (non-functional)
Background This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
Function Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive. [UniProt]
Cellular Localization Microsome membrane. Endoplasmic reticulum membrane. [UniProt]
Calculated MW 61 kDa
PTM The truncated form is probably unable to fold correctly and is rapidly degraded.

FMO2*1 is sumoylated at 'Lys-492'. [UniProt]

Images (1) Click the Picture to Zoom In

  • ARG58712 anti-FMO2 antibody WB image

    Western blot: 40 µg of A549, HeLa, MCF7, SW620 whole cell lysates stained with ARG58712 anti-FMO2 antibody at 0.5 µg/ml.