ARG58757
anti-FRZB antibody
anti-FRZB antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human
Overview
| Product Description | Rabbit Polyclonal antibody recognizes FRZB |
|---|---|
| Tested Reactivity | Hu |
| Predict Reactivity | Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | FRZB |
| Antigen Species | Human |
| Immunogen | Synthetic peptide around the middle region of Human FRZB. (within the following sequence: VVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERS) |
| Conjugation | Un-conjugated |
| Alternate Names | FRP-3; Frizzled-related protein 1; FRE; hFIZ; OS1; FrzB-1; FRZB-PEN; FRZB-1; Fritz; Secreted frizzled-related protein 3; SFRP3; FRZB1; Frezzled; FRITZ; FZRB; SRFP3; sFRP-3 |
Application Instructions
| Predict Reactivity Note | Predicted homology based on immunogen sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 92% | ||||||
|---|---|---|---|---|---|---|---|
| Application Suggestion |
|
||||||
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||
| Positive Control | DLD1 |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purified. |
| Buffer | PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. |
| Preservative | 0.09% (w/v) Sodium azide |
| Stabilizer | 2% Sucrose |
| Concentration | Batch dependent: 0.5 - 1 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links |
Swiss-port # Q92765 Human Secreted frizzled-related protein 3 |
|---|---|
| Gene Symbol | FRZB |
| Gene Full Name | frizzled-related protein |
| Background | The protein encoded by this gene is a secreted protein that is involved in the regulation of bone development. Defects in this gene are a cause of female-specific osteoarthritis (OA) susceptibility. [provided by RefSeq, Apr 2010] |
| Function | Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP3/FRZB appears to be involved in limb skeletogenesis. Antagonist of Wnt8 signaling. Regulates chondrocyte maturation and long bone development. [UniProt] |
| Calculated MW | 36 kDa |
Images (1) Click the Picture to Zoom In
-
ARG58757 anti-FRZB antibody WB image
Western blot: DLD1 cell lysate stained with ARG58757 anti-FRZB antibody at 1 µg/ml dilution.
