ARG58782
anti-GFI1 antibody
anti-GFI1 antibody for IHC-Formalin-fixed paraffin-embedded sections and Human
Overview
Product Description | Rabbit Polyclonal antibody recognizes GFI1 |
---|---|
Tested Reactivity | Hu |
Predict Reactivity | Ms, Rat |
Tested Application | IHC-P |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | GFI1 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to a sequence of Human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH). |
Conjugation | Un-conjugated |
Alternate Names | GFI-1; Growth factor independent protein 1; ZNF163; GFI1A; Zinc finger protein Gfi-1; SCN2; Zinc finger protein 163 |
Application Instructions
Application Suggestion |
|
||||
---|---|---|---|---|---|
Application Note | IHC-P: Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0) for 20 min. * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
Form | Liquid |
---|---|
Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 4% Trehalose. |
Preservative | 0.05% Sodium azide |
Stabilizer | 4% Trehalose |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links | |
---|---|
Gene Symbol | GFI1 |
Gene Full Name | growth factor independent 1 transcription repressor |
Background | This gene encodes a nuclear zinc finger protein that functions as a transcriptional repressor. This protein plays a role in diverse developmental contexts, including hematopoiesis and oncogenesis. It functions as part of a complex along with other cofactors to control histone modifications that lead to silencing of the target gene promoters. Mutations in this gene cause autosomal dominant severe congenital neutropenia, and also dominant nonimmune chronic idiopathic neutropenia of adults, which are heterogeneous hematopoietic disorders that cause predispositions to leukemias and infections. Multiple alternatively spliced variants, encoding the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008] |
Function | Transcription repressor essential for hematopoiesis. Functions in a cell-context and development-specific manner. Binds to 5'-TAAATCAC[AT]GCA-3' in the promoter region of a large number of genes. Component of several complexes, including the EHMT2-GFI1-HDAC1, AJUBA-GFI1-HDAC1 and RCOR-GFI-KDM1A-HDAC complexes, that suppress, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Regulates neutrophil differentiation, promotes proliferation of lymphoid cells, and is required for granulocyte development. Mediates, together with U2AF1L4, the alternative splicing of CD45 and controls T-cell receptor signaling. Regulates the endotoxin-mediated Toll-like receptor (TLR) inflammatory response by antagonizing RELA. Cooperates with CBFA2T2 to regulate ITGB1-dependent neurite growth. Controls cell-cycle progression by repressing CDKNIA/p21 transcription in response to TGFB1 via recruitment of GFI1 by ZBTB17 to the CDKNIA/p21 and CDKNIB promoters. Required for the maintenance of inner ear hair cells. [UniProt] |
Cellular Localization | Nucleus. [UniProt] |
Calculated MW | 45 kDa |
PTM | Ubiquitinated. Ubiquitination and degradation by the proteasome is inhibited by the ubiquitin ligase, ARIH2. [UniProt] |
Images (2) Click the Picture to Zoom In
-
ARG58782 anti-GFI1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human mammary cancer tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG58782 anti-GFI1 antibody at 1 µg/ml, overnight at 4°C.
-
ARG58782 anti-GFI1 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human rectal cancer tissue. Antigen Retrieval: Heat mediated was performed in Citrate buffer (pH 6.0, epitope retrieval solution) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG58782 anti-GFI1 antibody at 1 µg/ml, overnight at 4°C.