
anti-GNAQ antibody

anti-GNAQ antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human,Mouse,Rat


Product Description

Rabbit Polyclonal antibody recognizes GNAQ

Tested Reactivity Hu, Ms, Rat
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Target Name GNAQ
Species Human
Immunogen Synthetic peptide from Human GNAQ protein. (KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND)
Conjugation Un-conjugated
Full Name guanine nucleotide binding protein (G protein), q polypeptide
Alternate Names GAQ; SWS; CMC1; G-ALPHA-q; Guanine nucleotide-binding protein G(q) subunit alpha; Guanine nucleotide-binding protein alpha-q

Application Instructions

Application Suggestion
Tested Application Dilution
IHC-P0.5 - 1 µg/ml
WB0.1 - 0.5 µg/ml
Application Note Antigen Retrieval for IHC-P: Boiling the paraffin sections in 10mM Citrate buffer, pH6.0, for 20 min
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Calculated MW 42 kDa


Form Liquid
Purification Affinity purification with immunogen.
Buffer PBS, 0.025% Sodium azide and 2.5% BSA.
Preservative 0.025% Sodium azide
Stabilizer 2.5% BSA
Concentration 0.5 mg/ml
Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.


Database links

GeneID: 14682 Mouse GNAQ

GeneID: 2776 Human GNAQ

GeneID: 81666 Rat GNAQ

Gene Symbol GNAQ
Gene Full Name guanine nucleotide binding protein (G protein), q polypeptide
Background This locus encodes a guanine nucleotide-binding protein. The encoded protein, an alpha subunit in the Gq class, couples a seven-transmembrane domain receptor to activation of phospolipase C-beta. Mutations at this locus have been associated with problems in platelet activation and aggregation. A related pseudogene exists on chromosome 2.[provided by RefSeq, Nov 2010]
Function Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro) (By similarity). [UniProt]
PTM (Microbial infection) Deamidated at Gln-209 by Photorhabdus asymbiotica toxin PAU_02230, blocking GTP hydrolysis of heterotrimeric GNAQ or GNA11 and G-alphai (GNAI1, GNAI2 or GNAI3) proteins, thereby activating RhoA.

Images (4) Click the Picture to Zoom In

  • ARG10606 anti-GNAQ antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and Paraffin-embedded Human prostate cancer tissue stained with ARG10606 anti-GNAQ antibody.

  • ARG10606 anti-GNAQ antibody WB image

    Western blot: 1) Rat ovary, 2) Rat testis, 3) Mouse testis, 4) Human 22RV1 and 5) Human SKOV lysate stained with ARG10606 anti-GNAQ antibody.

  • ARG10606 anti-GNAQ antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and Paraffin-embedded Mouse testis tissue stained with ARG10606 anti-GNAQ antibody.

  • ARG10606 anti-GNAQ antibody IHC-P image

    Immunohistochemistry: Formalin-fixed and Paraffin-embedded Rat ovary tissue stained with ARG10606 anti-GNAQ antibody.