
anti-GPNMB antibody

anti-GPNMB antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human


Product Description

Rabbit Polyclonal antibody recognizes GPNMB

Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb
Tested Application IHC-P, WB
Specificity 100% homologous to both isoforms of hGPNMB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name GPNMB
Antigen Species Human
Immunogen Synthetic peptide around the N-terminus of Human GPNMB. (DENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVN)
Conjugation Un-conjugated
Full Name glycoprotein (transmembrane) nmb
Alternate Names Transmembrane glycoprotein HGFIN; HGFIN; NMB; Transmembrane glycoprotein NMB

Application Instructions

Predict Reactivity Note Homology Based On Immunogen Sequence: Cow: 100%; Dog: 79%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Application Suggestion
Tested Application Dilution
IHC-P4 - 8 µg/ml
WB1.0 µg/ml
Application Note IHC-P: Antigen Retrieval: Boil the paraffin sections in Sodium citrate, pH 6.0, for 20 mins.
* The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Calculated MW 64 kDa


Form Liquid
Purification Affinity purification with immunogen.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration 0.5 - 1 mg/ml
Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.


Database links

GeneID: 10457 Human GPNMB

Swiss-port # Q14956 Human Transmembrane glycoprotein NMB

Gene Symbol GPNMB
Gene Full Name glycoprotein (transmembrane) nmb
Background The protein encoded by this gene is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Function Could be a melanogenic enzyme. [UniProt]

Images (2) Click the Picture to Zoom In

  • ARG10645 anti-GPNMB antibody IHC-P image

    Immunohistochemistry: Human lung tissue stained with ARG10645 anti-GPNMB antibody at 4.0 - 8.0 µg/ml dilution.

  • ARG10645 anti-GPNMB antibody WB image

    Western blot: Human Fetal lung lysate stained with ARG10645 anti-GPNMB antibody at 1.0 µg/ml dilution.