ARG10675
anti-IGFBP3 antibody
anti-IGFBP3 antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes IGFBP3 |
---|---|
Tested Reactivity | Hu, Rat |
Tested Application | IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | IGFBP3 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to the sequence at a.a 214-252 (RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR) around the C-terminus of human IGFBP3 protein. |
Conjugation | Un-conjugated |
Full Name | Insulin Like Growth Factor Binding Protein 3 |
Alternate Names | IBP3; BP-53; IGF-binding protein 3; IGFBP-3 |
Application Instructions
Application Suggestion |
|
||||||
---|---|---|---|---|---|---|---|
Application Note | Antigen Retrieval for IHC-P: Boiling the paraffin sections in 10mM Citrate buffer, pH6.0, for 20 min * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
Calculated MW | 32 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 1X PBS, 0.025% Sodium azide and 2.7% BSA |
Preservative | 0.027% Sodium azide |
Stabilizer | 2.7% BSA |
Concentration | 0.5 mg/ml |
Storage instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database links |
Swiss-port # P15473 Rat Insulin-like growth factor-binding protein 3 Swiss-port # P17936 Human Insulin-like growth factor-binding protein 3 |
---|---|
Gene Symbol | IGFBP3 |
Gene Full Name | Insulin Like Growth Factor Binding Protein 3 |
Background | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
PTM | Phosphorylated by FAM20C in the extracellular medium. |