ARG10675
anti-IGFBP3 antibody
anti-IGFBP3 antibody for Western blot,IHC-Formalin-fixed paraffin-embedded sections and Human,Rat
Overview
| Product Description | Rabbit Polyclonal antibody recognizes IGFBP3 |
|---|---|
| Tested Reactivity | Hu, Rat |
| Tested Application | IHC-P, WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | IGFBP3 |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to the sequence at a.a 214-252 (RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR) around the C-terminus of human IGFBP3 protein. |
| Conjugation | Un-conjugated |
| Full Name | Insulin Like Growth Factor Binding Protein 3 |
| Alternate Names | IBP3; BP-53; IGF-binding protein 3; IGFBP-3 |
Application Instructions
| Application Suggestion |
|
||||||
|---|---|---|---|---|---|---|---|
| Application Note | Antigen Retrieval for IHC-P: Boiling the paraffin sections in 10mM Citrate buffer, pH6.0, for 20 min * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
||||||
| Calculated MW | 32 kDa |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 1X PBS, 0.025% Sodium azide and 2.7% BSA |
| Preservative | 0.027% Sodium azide |
| Stabilizer | 2.7% BSA |
| Concentration | 0.5 mg/ml |
| Storage instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database links |
Swiss-port # P15473 Rat Insulin-like growth factor-binding protein 3 Swiss-port # P17936 Human Insulin-like growth factor-binding protein 3 |
|---|---|
| Gene Symbol | IGFBP3 |
| Gene Full Name | Insulin Like Growth Factor Binding Protein 3 |
| Background | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
| PTM | Phosphorylated by FAM20C in the extracellular medium. |
