ARG59334
anti-Keratocan antibody
anti-Keratocan antibody for Western blot and Human,Mouse
Overview
| Product Description | Rabbit Polyclonal antibody recognizes Keratocan |
|---|---|
| Tested Reactivity | Hu, Ms |
| Predict Reactivity | Bov |
| Tested Application | WB |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Target Name | Keratocan |
| Antigen Species | Human |
| Immunogen | Synthetic peptide corresponding to aa. 77-109 of Human Keratocan. (YLQNNLIETIPEKPFENATQLRWINLNKNKITN) |
| Conjugation | Un-conjugated |
| Alternate Names | Keratan sulfate proteoglycan keratocan; KTN; SLRR2B; CNA2; Keratocan |
Application Instructions
| Application Suggestion |
|
||||
|---|---|---|---|---|---|
| Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. |
Properties
| Form | Liquid |
|---|---|
| Purification | Affinity purification with immunogen. |
| Buffer | 0.9% NaCl, 0.2% Na2HPO4, 0.05% Sodium azide and 5% BSA. |
| Preservative | 0.05% Sodium azide |
| Stabilizer | 5% BSA |
| Concentration | 0.5 mg/ml |
| Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
| Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
| Database Links | |
|---|---|
| Gene Symbol | KERA |
| Gene Full Name | keratocan |
| Background | The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2).[provided by RefSeq, May 2010] |
| Function | May be important in developing and maintaining corneal transparency and for the structure of the stromal matrix. [UniProt] |
| Cellular Localization | Secreted, extracellular space, extracellular matrix. [UniProt] |
| Calculated MW | 41 kDa |
| PTM | Binds keratan sulfate chains. [UniProt] |
Images (1) Click the Picture to Zoom In
-
ARG59334 anti-Keratocan antibody WB image
Western blot: 40 µg of Mouse testis, Mouse skeletal muscle, MCF-7 and A549 whole cell lysates stained with ARG59334 anti-Keratocan antibody at 0.5 µg/ml dilution.
