ARG42693
anti-TANK / TRAF2 antibody
anti-TANK / TRAF2 antibody for Flow cytometry,IHC-Frozen sections,IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human,Mouse,Rat
Overview
Product Description | Rabbit Polyclonal antibody recognizes TANK / TRAF2 |
---|---|
Tested Reactivity | Hu, Ms, Rat |
Tested Application | FACS, IHC-Fr, IHC-P, WB |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Target Name | TANK / TRAF2 |
Antigen Species | Human |
Immunogen | Synthetic peptide corresponding to a sequence of Human TANK / TRAF2. (MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQK) |
Conjugation | Un-conjugated |
Alternate Names | TRAF-interacting protein; TRAF2; I-TRAF; TRAF family member-associated NF-kappa-B activator; ITRAF |
Application Instructions
Application Suggestion |
|
||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Application Note | * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. | ||||||||||
Observed Size | ~ 48 kDa |
Properties
Form | Liquid |
---|---|
Purification | Affinity purification with immunogen. |
Buffer | 0.2% Na2HPO4, 0.9% NaCl, 0.05% Sodium azide and 4% Trehalose. |
Preservative | 0.05% Sodium azide |
Stabilizer | 4% Trehalose |
Concentration | 0.5 mg/ml |
Storage Instruction | For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. |
Note | For laboratory research only, not for drug, diagnostic or other use. |
Bioinformation
Database Links |
Swiss-port # P70347 Mouse TRAF family member-associated NF-kappa-B activator Swiss-port # Q92844 Human TRAF family member-associated NF-kappa-B activator |
---|---|
Gene Symbol | TANK |
Gene Full Name | TRAF family member-associated NFKB activator |
Background | The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
Function | Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. Negatively regulates NF-kappaB signaling and cell survival upon DNA damage (PubMed:25861989). Plays a role as an adapter to assemble ZC3H12A, USP10 in a deubiquitination complex which plays a negative feedback response to attenuate NF-kappaB activation through the deubiquitination of IKBKG or TRAF6 in response to interleukin-1-beta (IL1B) stimulation or upon DNA damage (PubMed:25861989). Promotes UBP10-induced deubiquitination of TRAF6 in response to DNA damage (PubMed:25861989). May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2. [UniProt] |
Cellular Localization | Cytoplasm. [UniProt] |
Calculated MW | 48 kDa |
PTM | Phosphorylated by IKBKE. [UniProt] |
Images (11) Click the Picture to Zoom In
-
ARG42693 anti-TANK / TRAF2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat small intestine tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42693 anti-TANK / TRAF2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody WB image
Western blot: 50 µg of samples under reducing condition. Rat brain, Rat lung, Rat spleen, Rat kidney, Mouse brain, Mouse lung, Mouse spleen and Mouse kidney lysates stained with ARG42693 anti-TANK / TRAF2 antibody at 0.5 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody FACS image
Flow Cytometry: A431 cells were blocked with 10% normal goat serum and then stained with ARG42693 anti-TANK / TRAF2 antibody (blue) at 1 µg/10^6 cells for 30 min at 20°C, followed by incubation with DyLight®488 labelled secondary antibody. Isotype control antibody (green) was rabbit IgG (1 µg/10^6 cells) used under the same conditions. Unlabelled sample (red) was also used as a control.
-
ARG42693 anti-TANK / TRAF2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human cholangiocarcinoma tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42693 anti-TANK / TRAF2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human placenta tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42693 anti-TANK / TRAF2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Rat spleen tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42693 anti-TANK / TRAF2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Human rectal cancer tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42693 anti-TANK / TRAF2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse kidney tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42693 anti-TANK / TRAF2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody IHC-Fr image
Immunohistochemistry: Frozen section of Human placenta tissue. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42693 anti-TANK / TRAF2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody IHC-P image
Immunohistochemistry: Paraffin-embedded Mouse liver tissue. Antigen Retrieval: Heat mediation was performed in Citrate buffer (pH 6.0) for 20 min. The tissue section was blocked with 10% goat serum. The tissue section was then stained with ARG42693 anti-TANK / TRAF2 antibody at 1 µg/ml dilution, overnight at 4°C.
-
ARG42693 anti-TANK / TRAF2 antibody WB image
Western blot: 50 µg of samples under reducing condition. HeLa, Human placenta, A549, MDA-MB-453, SW620, 22Rv1 and SW579 whole cell lysates stained with ARG42693 anti-TANK / TRAF2 antibody at 0.5 µg/ml dilution, overnight at 4°C.