ARG40779

anti-TRPM3 antibody

anti-TRPM3 antibody for Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes TRPM3
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb, Zfsh
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name TRPM3
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human TRPM3. (Within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD)
Conjugation Un-conjugated
Alternate Names Transient receptor potential cation channel subfamily M member 3; LTrpC3; GON-2; Melastatin-2; LTRPC3; MLSN2; LTrpC-3; Long transient receptor potential channel 3

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Application Suggestion
Tested Application Dilution
WB1 - 2 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Positive Control HepG2

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 80036 Human TRPM3

Swiss-port # Q9HCF6 Human Transient receptor potential cation channel subfamily M member 3

Gene Symbol TRPM3
Gene Full Name transient receptor potential cation channel, subfamily M, member 3
Background The product of this gene belongs to the family of transient receptor potential (TRP) channels. TRP channels are cation-selective channels important for cellular calcium signaling and homeostasis. The protein encoded by this gene mediates calcium entry, and this entry is potentiated by calcium store depletion. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Function Calcium channel mediating constitutive calcium ion entry. Its activity is increased by reduction in extracellular osmolarity, by store depletion and muscarinic receptor activation. [UniProt]
Cellular Localization Membrane; Multi-pass membrane protein. [UniProt]
Calculated MW 198 kDa

Images (2) Click the Picture to Zoom In

  • ARG40779 anti-TRPM3 antibody WB image

    Western blot: HepG2 cell lysate stained with ARG40779 anti-TRPM3 antibody at 1.25 µg/ml dilution.

  • ARG40779 anti-TRPM3 antibody WB image

    Western blot: Human uterus tumor (left) and testis tumor (right) stained with ARG40779 anti-TRPM3 antibody as negative and positive control.