ARG10674

anti-IGFBP2 antibody

anti-IGFBP2 antibody for Western blot and Human,Rat

Overview

Product Description Rabbit Polyclonal antibody recognizes IGFBP2
Tested Reactivity Hu, Rat
Tested Application WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name IGFBP2
Antigen Species Human
Immunogen Synthetic peptide corresponding to the sequence at a.a 228-257 (QQELDQVLERISTMRLPDERGPLEHLYSLH) around the C-terminus of human IGFBP2 protein.
Conjugation Un-conjugated
Full Name Insulin Like Growth Factor Binding Protein 2
Alternate Names IBP2; IGF-BP53; IGF-binding protein 2; IGFBP-2

Application Instructions

Application Suggestion
Tested Application Dilution
WB0.1 - 0.5 μg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Calculated MW 35 Kda

Properties

Form Liquid
Purification Affinity purification with immunogen.
Buffer 1X PBS, 0.025% Sodium azide and 2.6% BSA
Preservative 0.026% Sodium azide
Stabilizer 2.6% BSA
Concentration 0.5 mg/ml
Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database links

GeneID: 25662 Rat IGFBP2

GeneID: 3485 Human IGFBP2

Swiss-port # P12843 Rat Insulin-like growth factor-binding protein 2

Swiss-port # P18065 Human Insulin-like growth factor-binding protein 2

Gene Symbol IGFBP2
Gene Full Name Insulin Like Growth Factor Binding Protein 2
Background The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene. [provided by RefSeq, Sep 2015]
Function Inhibits IGF-mediated growth and developmental rates. IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. [UniProt]
PTM O-glycosylated.