ARG58376

anti-TBX20 antibody

anti-TBX20 antibody for IHC-Formalin-fixed paraffin-embedded sections,Western blot and Human

Overview

Product Description Rabbit Polyclonal antibody recognizes TBX20
Tested Reactivity Hu
Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Pig, Rb, Zfsh
Tested Application IHC-P, WB
Host Rabbit
Clonality Polyclonal
Isotype IgG
Target Name TBX20
Antigen Species Human
Immunogen Synthetic peptide around the N-terminal region of Human TBX20.
(located within the following region: MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSS)
Conjugation Un-conjugated
Alternate Names T-box protein 20; ASD4; T-box transcription factor TBX20

Application Instructions

Predict Reactivity Note Predicted Homology Based On Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Application Suggestion
Tested Application Dilution
IHC-P5 µg/ml
WB1 µg/ml
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size ~ 49 kDa

Properties

Form Liquid
Purification Affinity purified.
Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose.
Preservative 0.09% (w/v) Sodium azide
Stabilizer 2% Sucrose
Concentration Batch dependent: 0.5 - 1 mg/ml
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 57057 Human TBX20

Swiss-port # Q9UMR3 Human T-box transcription factor TBX20

Gene Symbol TBX20
Gene Full Name T-box 20
Background This gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box, and they are transcription factors involved in the regulation of developmental processes. This gene is essential for heart development. Mutations in this gene are associated with diverse cardiac pathologies, including defects in septation, valvulogenesis and cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009]
Function Acts as a transcriptional activator and repressor required for cardiac development and may have key roles in the maintenance of functional and structural phenotypes in adult heart. [UniProt]
Calculated MW 49 kDa

Images (3) Click the Picture to Zoom In

  • ARG58376 anti-TBX20 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human kidney stained with ARG58376 anti-TBX20 antibody at 5 µg/ml dilution.

  • ARG58376 anti-TBX20 antibody WB image

    Western blot: HepG2 cell lysate stained with ARG58376 anti-TBX20 antibody at 1 µg/ml dilution.

  • ARG58376 anti-TBX20 antibody IHC-P image

    Immunohistochemistry: Paraffin-embedded Human muscle stained with ARG58376 anti-TBX20 antibody.