ARG46724

anti-ZBP1 antibody [3H02]

anti-ZBP1 antibody [3H02] for ICC/IF,IHC-Formalin-fixed paraffin-embedded sections,Immunoprecipitation,Western blot and Human

Overview

Product Description Rabbit Monoclonal antibody [3H02] recognizes ZBP1
Tested Reactivity Hu
Tested Application ICC/IF, IHC-P, IP, WB
Host Rabbit
Clonality Monoclonal
Clone 3H02
Isotype IgG
Target Name ZBP1
Antigen Species Human
Immunogen Recombinant protein chuman ZBP1.
MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPA TWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALV IAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRPEDS
Conjugation Un-conjugated
Alternate Names ZBP1; Z-DNA Binding Protein 1; DLM1; DAI; C20orf183; DLM-1; Tumor Stroma And Activated Macrophage Protein DLM-1; DNA-Dependent Activator Of IRFs; Z-DNA-Binding Protein 1; DJ718J7.3; DNA-Dependent Activator Of IFN-Regulatory Factors; Chromosome 20 Open Reading Frame 183

Application Instructions

Application Suggestion
Tested Application Dilution
ICC/IF1:100 - 1:400
IHC-P1:200 - 1:800
IP0.5 μg - 4 μg antibody for 500 μg - 700 μg extracts of whole cells
WB1:10000 - 1:60000
Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist.
Observed Size 44 kDa; 58 kDa

Properties

Form Liquid
Purification Affinity chromatography purified
Buffer PBS, 0.09% sodium azide, 50% glycerol and 0.5% BSA
Preservative 0.09% sodium azide
Stabilizer 50% glycerol and 0.5% BSA
Storage Instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use.
Note For laboratory research only, not for drug, diagnostic or other use.

Bioinformation

Database Links

GeneID: 81030 Human ZBP1

Swiss-port # Q9H171 Human Z-DNA-binding protein 1

Gene Symbol ZBP1
Gene Full Name Z-DNA Binding Protein 1
Background This gene encodes a Z-DNA binding protein. The encoded protein plays a role in the innate immune response by binding to foreign DNA and inducing type-I interferon production. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
Function Key innate sensor that recognizes and binds Z-RNA structures, which are produced by a number of viruses, such as herpesvirus, orthomyxovirus or flavivirus, and triggers different forms of cell death. [UniProt]
Cellular Localization Cytoplasm; Nucleus. [UniProt]
Calculated MW 46 kDa
PTM Phosphorylated. [UniProt]

Images (4) Click the Picture to Zoom In

  • ARG46724 anti-ZBP1 antibody [3H02] IHC-P image

    Immunohistochemistry: Human breast stained with ARG46724 anti-ZBP1 antibody [3H02].

  • ARG46724 anti-ZBP1 antibody [3H02] ICC/IF image

    Immunofluorescence: U266 stained with ARG46724 anti-ZBP1 antibody [3H02].

  • ARG46724 anti-ZBP1 antibody [3H02] IP image

    Immunoprecipitation: U266 lysate immunoprecipitated with 1 μg ARG46724 anti-ZBP1 antibody [3H02].

  • ARG46724 anti-ZBP1 antibody [3H02] WB image

    Western blot: U266 stained with ARG46724 anti-ZBP1 antibody [3H02].